PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03262.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 432aa    MW: 46348.6 Da    PI: 8.2269
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03262.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.24e-1866113148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg W++eEde+l+++v+ +G  +W++++++ g+ R++k+c++rw +yl
  Zmw_sc03262.1.g00020.1.am.mk  66 RGLWSPEEDEKLLRYVTAHGHSCWSSVPKHAGLQRCGKSCRLRWINYL 113
                                   788*******************************************97 PP

2Myb_DNA-binding49.21.2e-15119162146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg ++ +E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w++
  Zmw_sc03262.1.g00020.1.am.mk 119 RGTFSDQEERTIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 162
                                   899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-2757116IPR009057Homeodomain-like
PROSITE profilePS5129418.54961113IPR017930Myb domain
SuperFamilySSF466895.99E-2863160IPR009057Homeodomain-like
SMARTSM007179.9E-1465115IPR001005SANT/Myb domain
PfamPF002494.7E-1666113IPR001005SANT/Myb domain
CDDcd001676.26E-1269113No hitNo description
PROSITE profilePS5129425.203114168IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-24117169IPR009057Homeodomain-like
SMARTSM007173.6E-15118166IPR001005SANT/Myb domain
PfamPF002493.3E-14119162IPR001005SANT/Myb domain
CDDcd001674.31E-11121161No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MGLFFLRFTS PGRPAASLQR VPSNWKGLSQ VLATARPYTV GGEGRRGRRG RPAMGHHCCS  60
KQKVKRGLWS PEEDEKLLRY VTAHGHSCWS SVPKHAGLQR CGKSCRLRWI NYLRPDLKRG  120
TFSDQEERTI IDVHRILGNR WAQIAKHLPG RTDNEVKNFW NSCIKKKLIA QGLDPKTHNL  180
LPASRSLLHG NGANPSNPTQ FHHPNGGSAV AATTPPFTIS SPTKPAFDAL TVVPPPEVAP  240
ALYDLPNPGM LMPQDQAAVA TIPGYPYSDR GHGVLMSFRD QNAGLQGSMD FMNGSSSSSS  300
MDHAVGMQNG NGFSQGMSAA FMDETAAMWA ATAAVEPGMG AGMEMVQQPP PPPPPQELVQ  360
GEVVSSPTVM NGGGAVEEKS LDMMDVSSVY SGVGTNAAFD LELMGPCGLF CSGGGGGCSC  420
GRNDIDHLQW DC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-33661687108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957753.10.0PREDICTED: transcription factor MYB12-like
TrEMBLK3ZU710.0K3ZU71_SETIT; Uncharacterized protein
STRINGSi030152m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97513545